Hi dZddlZddlZddlZddlZddlmZddlmZddlmZddlm Z ddlm Z ddlm Z d Z e d Z e d e _e jjgd e jjD] Zee jee d ez!e jjjD]%Zee jjee dez&e jjjD]%Zee jjee dez&e jD]"Zedkr ee ee dez#[ eZdZdZeejdZeejdZeZejdd dvr'e!edreej"dZdZ#dZ$dZ%dZ&e!e j'drdZ(nd Z(Gd!d"e j)j*Z+Gd#d$Z,Gd%d&Z-e-e,'Z)ej.d(dd(fd)Z/d*Z0d+Z1d,Z2d9d-Z3d.Z4d/Z5d0Z6d1Z7d2Z8 e j9:dd(3n#e j9j;$rd(Zed5dddd4d4dfd7Z?d8Z@e?e j'_?e>e j'_>dS):z1greendns - non-blocking DNS support for Eventlet N)patcher) _socket_nodns)os)time)select)sslchtttttd}t j|fi|S)N)rrrsocketr)rrrrrrimport_patched) module_namemoduless ^/home/mmwave/public_html/mmwave/venv/lib/python3.11/site-packages/eventlet/support/greendns.pyr r 0s:  G  !+ 9 9 9 99dnsz dns.rdtypes) dnskeybasedsbasetxtbasez dns.rdtypes.zdns.rdtypes.IN.zdns.rdtypes.ANY.rdtypeszdns.g$@zLookup timed outzName or service not knownEVENTLET_DEPRECATED_EAI_NODATA)1yyes EAI_NODATA#No address associated with hostnamec |j|jN) __class__args)error_instances r_raise_new_errorr!cs ". "N$7 88rct|tsdS tj|dS#tjj$rYdSwxYw)z+Return True if host is a valid IPv4 addressFT) isinstancestrripv4 inet_aton exception SyntaxErrorhosts r is_ipv4_addrr+gsd dC u 4   t = $uus:AAct|tsdS|ddd} tj|dS#tjj$rYdSwxYw)z+Return True if host is a valid IPv6 addressF%rT)r#r$splitripv6r&r'r(r)s r is_ipv6_addrr1ss| dC u ::c1  a D 4   t = $uusAA.-A.c>t|pt|S)z3Return True if host is a valid IPv4 or IPv6 address)r+r1r)s r is_ip_addrr3s    3d!3!33r_compute_expirationc,||Sr)r4querytimeouts rcompute_expirationr9s((111rc8||dS)Nr.)_compute_timesr6s rr9r9s##G,,Q//rceZdZdZddZdS) HostsAnswerz%Answer class for HostsResolver objectTcd|_||_||_||_||_|s |rt j||_t|drtj |j znd|_ dS)a^Create a new answer :qname: A dns.name.Name instance of the query name :rdtype: The rdatatype of the query :rdclass: The rdataclass of the query :rrset: The dns.rrset.RRset with the response, must have ttl attribute :raise_on_no_answer: Whether to raise dns.resolver.NoAnswer if no answer. Nttlr) responseqnamerdtyperdclasscanonical_namerresolverNoAnswerrrsethasattrrr? expiration)selfrArBrCrGraise_on_no_answers r__init__zHostsAnswer.__init__s    # *+ *,'')) ) (/u(=(=E49;; 9%%CD rN)T)__name__ __module__ __qualname____doc__rLrrr=r=s4//FFFFFFrr=ceZdZdZejdejZdefdZ dZ dZ e j je jjdddfd Zd ZdS) HostsResolverzClass to parse the hosts file Attributes ---------- :fname: The filename of the hosts file in use. :interval: The time between checking for hosts file modification z \s* # Leading space ([^\r\n#]*?) # The actual match, non-greedy so as not to include trailing space \s* # Trailing space (?:[#][^\r\n]+)? # Comments (?:$|[\r\n]+) # EOF or newline Nc0i|_i|_i|_||_||_|Lt jdkrd|_n4t jdkr$t jd|_d|_ |jr| dSdS)Nposixz /etc/hostsntz'%SystemRoot%\system32\drivers\etc\hostsr) _v4_v6_aliasesintervalfnamernamepath expandvars _last_load_load)rJr[rZs rrLzHostsResolver.__init__s    =w'!!) DW//>@@  :  JJLLLLL  rc( t|jd5}|}dddn #1swxYwYn#t$rgcYSwxYw|d}t d|j|S)zRead the contents of the hosts file Return list of lines, comment lines and empty lines are excluded. Note that this performs disk I/O so can be blocking. rbNignore)errors)openr[readOSErrordecodefilterLINES_REfindall)rJfpfdataudatas r _readlineszHostsResolver._readliness dj$'' "2  " " " " " " " " " " " " " " "   III  H --dDM11%88999s-A8 A<A<A AAc|}|j|j|j|D]}|}t |dkr*|d}t|r|j}n.t|r| dr{|j}n|d }|||<|D]%}| }|||<||j|<&tj |_ dS)zjLoad hosts file This will unconditionally (re)load the data from the hosts file. rfe80N)rorWclearrXrYr/lenpopr+r1 startswithlowerrr_)rJlineslinepartsipipmapcnamealiass rr`zHostsResolver._loadsD !!    - -DJJLLE5zzA~~1BB b!! ==((IIaLL&&((EE%L - - !e ', e$$ -)++rFTc tj}|j|jz|kr|tjj}t|tr"|}tj |}nYt|tr5| d}tj |}nt|}| }tj|||} |j|jz|z | _|tjjkr|tjjkr|j|} | s6|r"|j|dd} | r>| tjjj||| n|tjjkr|tjjkr|j|} | s6|r"|j|dd} | r>| tjjj||| n|tjjkr|tjjkr|j|} | s6|r"|j|dd} | r[| tjjj||tj | t;|||| |S)aYQuery the hosts file The known rdtypes are dns.rdatatype.A, dns.rdatatype.AAAA and dns.rdatatype.CNAME. The ``rdclass`` parameter must be dns.rdataclass.IN while the ``tcp`` and ``source`` parameters are ignored. Return a HostAnswer instance or raise a dns.resolver.NoAnswer exception. asciiN)rr_rZr`r rdataclassINr#r$r\ from_textbytesrhrwrGRRsetr? rdatatypeArWget is_absoluteaddrAAAArXCNAMErYANYr=) rJrArBrCtcpsourcerKnowr\rGaddrr}s rr7zHostsResolver.querysikk ?T] *S 0 0 JJLLL.# eS ! ! DH&&u--EE u % % <<((DH&&u--EEu::Dzz|| w77Odm3c9 cn' ' 'Fcmo,E,E8<<%%D /E--// /x||D"I.. E #+.*,,WfdCCDDD ) ) )f 8J.J.J8<<%%D /E--// /x||D"I.. K #+.-227FDIIJJJ ) ) )f 8K.K.KM%%d++E 5U..00 5 ))$ss)44 A #+//55VSX%7%7%>%>@@AAA5&'5:LMMMrcg}||jvr|j|}n|}|||jD] \}}||kr||!|||S)z1Return a list of all the aliases of a given cname)rYappenditemsremove)rJhostnamealiasescannonr~r}s r getaliaseszHostsResolver.getaliases-s  t} $ $]8,FFFv M//11 & &LE5u%%%x   r)rMrNrOrPrecompileVERBOSErj HOSTS_TTLrLror`rrrrrr7rrQrrrSrSsrz  H"I :::$&&&@#&-/3>;L/N/N/N/NbrrSceZdZdZd dZedZejdZdZe j j e j j ddd e j j e j jfd fd Zd ZdS) ResolverProxyzResolver class which can also use /etc/hosts Initialise with a HostsResolver instance in order for it to also use the hosts file. N/etc/resolv.confc0||_||_d|_dS)ahInitialise the resolver proxy :param hosts_resolver: An instance of HostsResolver to use. :param filename: The filename containing the resolver configuration. The default value is correct for both UNIX and Windows, on Windows it will result in the configuration being read from the Windows registry. N)_hosts _filename_cached_resolver)rJhosts_resolverfilenames rrLzResolverProxy.__init__Fs"% ! !%rcF|j||jSr)rrsrJs r _resolverzResolverProxy._resolverXs!  ( JJLLL$$rc||_dSr)r)rJvalues rrzResolverProxy._resolver^s %rctj|j|_tj|j_dS)N)r)rrEResolverrrLRUCachecachers rrszResolverProxy.clearbs<...GG"|4466rFTc \ gd dttsttr tjd fd}  fd} |jrN|tjjkr9||vr5| |jj |dr d d |s | S| |j j ||||dtd kr>| |j j  tjj ||||d| S) aPQuery the resolver, using /etc/hosts if enabled. Behavior: 1. if hosts is enabled and contains answer, return it now 2. query nameservers for qname if use_network is True 3. if qname did not contain dots, pretend it was top-level domain, query "foobar." and append to previous result )NNrNz0.0.0.0c6 ||i|}n#t$r}|d<Yd}~dSd}~wwxYw|jit|jrUd|d<n%dj|jdxxt|jz cc<dS)Nr.FrrqT) ExceptionrGrt union_update)funrkwargsaeresults rstepz!ResolverProxy.query..stepys C(((   q uuuuu w"s17||"!9$ !F1II1IO00999q S\\) 4s &!&cd'rddkrtjjdSd/s%tdtjjsdtjf)Nrrqr.)qnames)rrErFr#NXDOMAIN)rArKrsrendz ResolverProxy.query..endsay$%0&)q..,//ay ay$%$Zq 3K|]}t|jVdSr)r$target.0rrs r z+ResolverProxy.getaliases..s*BB"s29~~BBBBBBrr) rrrr7rrrextendrGrrErFr)rJrranss rrzResolverProxy.getaliasess ; k,,X66GGG ) )n**8S]5HIIBB BBBBBBq6= L)3<+@A     )s*B%B+*B+)Nr)rMrNrOrPrLpropertyrsetterrsrrrrrrr7rrQrrrr?s %%%%$%%X% &&&777#&-/3>;L!mos}/AB====~rr)rTc|tjkrtjj}nG|tjkrtjj}n%ttjd|t} | ||||S#tj j $rE|sAttj ||tjjddcYSwxYw#tjj$rt't(YdStjj$rt't,YdSwxYw)a8Resolve a name for a given family using the global resolver proxy. This method is called by the global getaddrinfo() function. If use_network is False, only resolution via hosts file will be performed. Return a dns.resolver.Answer instance. If there is no answer it's rrset will be emtpy. zAddress family not supportedN)rKrF)r AF_INETrrrAF_INET6rgaierror EAI_FAMILYrEr7rr=r\Namerrr'Timeoutr!EAI_EAGAIN_ERROR DNSExceptionEAI_NODATA_ERROR)r\familyraises_proxyrrBs rresolversa 6? " "#oof/<>> >~ + <<f,7 99 9|$    K"38==#6#6#)3>+. s$$G$GBRZ$G$G$G$G$G$Grcg|] }|j SrQrrs r z'_getaddrinfo_lookup..777BRZ777rc"g|] }d|jz S)z::ffff:rrs rrz'_getaddrinfo_lookup..sGGGBRZ/GGGrcg|] }|j SrQrrs rrz'_getaddrinfo_lookup..rr)r AI_NUMERICHOSTr!EAI_NONAME_ERROR AF_UNSPECrrrrGrrerrno EAI_AGAINr AI_V4MAPPEDAI_ALLr$rA) r*rflagsaddrserrrqfamilyanswerrs r_getaddrinfo_lookuprs  v$$+)*** E !!!(  K"OV^< H HH$T7E{SSSF |H $G$G&,$G$G$GGGG wv'79I9OQaQg&hhhCCCCCC   ?5?I 6? " "uv/A'A "v66 < 877&,777E H - HT6>599F| HGG&,GGGvu-- < 877&,777E v|  e ##sBC%-CCc t|tr)|dd}n*t|tr|d}|$t |st |||\}}n|}|g}|tjzdtj z z}g} d} |D]a} t | |||||} n)#t$r} |tj zr| } Yd} ~ Cd} ~ wwxYw| | b| s)| r| ttjd|tj zrnt |s5t!|dd}| d} | d| d| d|| d f| d<| S) aCReplacement for Python's socket.getaddrinfo This does the A and AAAA lookups asynchronously after which it calls the OS' getaddrinfo(3) using the AI_NUMERICHOST flag. This flag ensures getaddrinfo(3) does not use the network itself and allows us to respect all the other arguments like the native OS. idnarNzNo address foundrr.rq)r#r$encoderhrr3rr r AI_CANONNAME getaddrinforg AI_ADDRCONFIGrr EAI_NONAMEr)r*portrtypeprotorrAraiflagsresrrairs rrr!s$${{6""))'22 D% ${{7##  4 0 0*4?? uuv,,&:M1MNG C C   ##D$$(%::BB   v++     2 E  Ioof/1CDDD v""5%   H!%((//88??GGE VQ%A1ube4A Js<C D&C=<C==Dc\t|r|St|}|djS)z-Replacement for Python's socket.gethostbynamer)r+rr)rrGs r gethostbynamerKs1H H  E 8 rct|r|g|gfSt|}t|}d|jD}t |j}|ddkr |dd}|||fS)z0Replacement for Python's socket.gethostbyname_excg|] }|j SrQrrs rrz$gethostbyname_ex..Ys , , ,BRZ , , ,rr.N)r+rrrGr$rA)rrrrrAs rgethostbyname_exr SsH*"xj)) (  C""G , ,#) , , ,E  NNE RyCcrc  7E ""rc@ |\}}nP#ttf$r<t|ts~tdt t YnwxYw|t jzr#|t jzrt t t|r t tj |tjj}t#|dkrt%d|djd}nu#tjj$r'|t jzrt t.Yn;tjj$r'|t jzrt t YnwxYw t |}t#|dkrt%d|t jzr |dj}ng#tjj$rt t.Yn=tjj$r't t jdfwxYw|t jzs.|t jzrdpd }t ||}||fS) zTReplacement for Python's socket.getnameinfo. Currently only supports IPv4. z(getnameinfo() argument 1 must be a tupler.z'sockaddr resolved to multiple addressesrT)omit_final_dotrudpr) ValueError TypeErrorr#tupler!rr NI_NAMEREQDNI_NUMERICHOSTr+rEr7r reversename from_addressrPTRrtrgrto_textr'rrrrrrNI_NUMERICSERVNI_DGRAM getservbyport)sockaddrrr*rrGrs r getnameinfor`s / dd  "///(E** /FGG G - . . . . ./ ""+1F)F+)***D5 3NN,,T22CM4EGGE5zzA~~GHHH8?**$*??DD}$ 3 3 3v)) 3 !1222}) 3 3 3v)) 3 !1222 3 LNN4((E5zzA~~GHHHv,, (Qx'}$ / / / - . . . . .}) L L L//"$IJLL L L-- 5V_,7%@5E''e44D $<s<A AAB D''7F!6FFAG88(I":IcXt}|dkr ||}nT#tj$rB|t jz dkrt jjtj dYmwxYw|dkrt|t|z }||z }|dk|S)acoro friendly replacement for dns.query._net_read Read the specified number of bytes from sock. Keep trying until we either get the desired amount, or we hit EOF. A Timeout exception will be raised if the operation is not completed by the expiration time. r{Gz?r) bytearrayrecvr r8rrr'reventletsleepEOFErrorrt)sockcountrIsns r _net_readr's  A !))  %  AA~   DIKK'3..m++ N4 H   88NA Q !)) Hs,AA=<A=cd}t|}||krj ||||dz }n@#tj$r.|t jz dkrt jjYnwxYw||khdSdS)zcoro friendly replacement for dns.query._net_write Write the specified data to the socket. A Timeout exception will be raised if the operation is not completed by the expiration time. rNr)rtsendr r8rrr'r)r#datarIcurrentls r _net_writer-s G D A A++ , tyyghh00 0GG~ , , ,DIKK'3..m++/. , A++++++s ::A76A7)raise_on_truncationF5c |} |9 tj|}n#tjj}YnxYw|tjjkr ||f}|||f}n_|tjjkrJtjtj|}||ddf}|||ddf}| r| }n%t |tj }| | ttj |}||| || |nT#tj$rB|t#jz dkrtjjt)jdYiwxYwd} |r+|t#jz dkrtjj|rt)jdd} |d\} }n#tj$rYqwxYwtj|dtjjkr\|d}tjtj|}||d|d |d f}||kr)|rtj d |d | t0r0tj| |j|j|| | }n.tj| |j|j|| }||stj n[#tjj$r5}| r-||sYd}~d}~wt@$r| rY(wxYw |!n#|!wxYw|S)aXcoro friendly replacement for dns.query.udp Return the response obtained after sending a query via UDP. @param q: the query @type q: dns.message.Message @param where: where to send the message @type where: string containing an IPv4 or IPv6 address @param timeout: The number of seconds to wait before the query times out. If None, the default, wait forever. @type timeout: float @param port: The port to which to send the message. The default is 53. @type port: int @param af: the address family to use. The default is None, which causes the address family to use to be inferred from the form of of where. If the inference attempt fails, AF_INET is used. @type af: int @rtype: dns.message.Message object @param source: source address. The default is the IPv4 wildcard address. @type source: string @param source_port: The port from which to send the message. The default is 0. @type source_port: int @param ignore_unexpected: If True, ignore responses from unexpected sources. The default is False. @type ignore_unexpected: bool @param one_rr_per_rrset: If True, put each RR into its own RRset. @type one_rr_per_rrset: bool @param ignore_trailing: If True, ignore trailing junk at end of the received message. @type ignore_trailing: bool @param raise_on_truncation: If True, raise an exception if the TC bit is set. @type raise_on_truncation: bool @param sock: the socket to use for the query. If None, the default, a socket is created. Note that if a socket is provided, it must be a nonblocking datagram socket, and the source and source_port are ignored. @type sock: socket.socket | None @param ignore_errors: if various format errors or response mismatches occur, continue listening. @type ignore_errors: boolNrTrrFrr.rqzgot a response from z instead of )keyring request_macone_rr_per_rrsetignore_trailingr.r2r3r4r5)"to_wirerinetaf_for_addressrrr0 inet_ntoar&r SOCK_DGRAM settimeoutr9r7bindsendtor8rr'rr r!recvfromUnexpectedSource_handle_raise_on_truncationmessage from_wirer2mac is_response BadResponse Truncatedrclose)qwherer8rafr source_portignore_unexpectedr4r5r.r# ignore_errorswire destination where_truncr%rItriedrrrrs rr r s0^ 99;;D z "((//BB "!BBB SX dm  k*F sx h((););E)B)BCC "D!Q/  k1a0F 1  MM"f/ 0 0LLH' 7;;   FF6NNN  {+++>    +s22-//t$$$  6  ,*ty{{2c99m++ %t$$$E '(zz%'8'8$||>    x&&|A7738;LLL#Ax))#(*<*MBU .WWAA --d67i:;%?O>M .OOA }}Q''2)//111;(    qyy{{)C)CHHHH    H      Hs8A 2O2EO2AF*'O2)F**A O26HO2H!O2 H!!CO2(BNO2O)O>O2OOO2OO22Pc |} |9 tj|}n#tjj}YnxYw|tjjkr ||f} |||f}n#|tjjkr||ddf} |||ddf}| r| } n%t |t j} | | ttj |} || | | | nT#t j $rB| tjz dkrtjjt#jdYhwxYwt'| }t)jd|| z}t-| || t/| d| }t)jd|\}t3t/| || } | n#| wxYwtj| |j|j||}||stj |S) acoro friendly replacement for dns.query.tcp Return the response obtained after sending a query via TCP. @param q: the query @type q: dns.message.Message object @param where: where to send the message @type where: string containing an IPv4 or IPv6 address @param timeout: The number of seconds to wait before the query times out. If None, the default, wait forever. @type timeout: float @param port: The port to which to send the message. The default is 53. @type port: int @param af: the address family to use. The default is None, which causes the address family to use to be inferred from the form of of where. If the inference attempt fails, AF_INET is used. @type af: int @rtype: dns.message.Message object @param source: source address. The default is the IPv4 wildcard address. @type source: string @param source_port: The port from which to send the message. The default is 0. @type source_port: int @type ignore_unexpected: bool @param one_rr_per_rrset: If True, put each RR into its own RRset. @type one_rr_per_rrset: bool @param ignore_trailing: If True, ignore trailing junk at end of the received message. @type ignore_trailing: bool @param sock: the socket to use for the query. If None, the default, a socket is created. Note that if a socket is provided, it must be a nonblocking datagram socket, and the source and source_port are ignored. @type sock: socket.socket | NoneNrTrrz!Hrqr6)!r7rr8r9rrr SOCK_STREAMr<r9r7r=connectr8rr'rr r!rtstructpackr-r'unpackrrHrBrCr2rDrErF)rIrJr8rrKrrLr4r5r#rOrPr%rIr,tcpmsgldatarSs rrr^sjL 99;;D z "((//BB "!BBB SX dm  k*F sx dAq)  k1a0F 2  MM"f0 1 1LL' 7;;   FF6NNN   +&&&>    +s22-//t$$$   IIT1%%,1fj)))!Q ++}T5))Yq!Z0011    dAI15/?.=  ? ?A ==  &i##%%% Hs;8A 2HDHAE-*H,E--BHHc8tdSr)rErsrQrrresetr]s NNr)rrrr)ArPrrWsysr reventlet.greenrrrrrr rr__all__rpkgsetattrrrr DNS_QUERY_TIMEOUTrrrrrrrenvironrrwrHrr!r+r1r3r7r9rEAnswerr=rSrrrrrrrrr rr'r-rBrC ShortHeaderrArr rr]rQrrrgsvD ((((((!!!!!! : : :nUn]++  >>>??? ; DDC GCKnn^c-ABBCCCC ;> !JJC GCKNC0AC0G!H!HIIII ;? "LLC GCKOS..1Cc1I"J"JKKKK ;44C i GCnnVc\223333   ??6#35GHH??6#46QRR$JNN3R88>>@@DUUU GFL ) )Vv'8:_``999      444 739+,,02222000FFFFF#,%FFF2TTTTTTTTnttttttttn =  8 8 8 T + + + +F " " " + + +%$%$%$P''''T # # #222j   0,,,&(K"$7777 {'''"&((("'( ," !u!ER R R R j," !DX X X X v   s$JJJJ